PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 319aa    MW: 36656.8 Da    PI: 8.0765
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629334.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-5371361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeel+++yLkkk++ +k+++ evi+evd++k+ePw+L++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk +
  XP_009629334.1   7 VPPGFRFHPTDEELLHYYLKKKLSFQKFDM-EVIREVDLNKIEPWELQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCI 100
                     69****************************.99**************964444222455************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      + + +++g++ktLvfy+grap+g+ktdW+mheyrle
  XP_009629334.1 101 RN-TLKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 136
                     *9.9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-595155IPR003441NAC domain
PROSITE profilePS5100558.0547155IPR003441NAC domain
PfamPF023656.8E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASSGGVPPG FRFHPTDEEL LHYYLKKKLS FQKFDMEVIR EVDLNKIEPW ELQERCKIGS  60
TPQNEWYFFS HKDRKYPTGS RTNRATNAGF WKATGRDKCI RNTLKKIGMR KTLVFYRGRA  120
PHGQKTDWIM HEYRLEDSDE NSSEDGWVIC RVFKKKNLFK VIGNNNEGSA ASSDLLNNTS  180
IHQPRTNFTH KDSPYLLQHQ QHGHDHGLNY SHIPTAVAAT FPHEYNSHNN NIQLAQNFMS  240
LGYHHPQDFS SGPLPTSQQS APCESGLEVA SSHQNMNNDQ WGMINDRLVE DANVASSSSM  300
NQINHLPLRG EMDFWSYGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-52715717167NO APICAL MERISTEM PROTEIN
1ut4_B1e-52715717167NO APICAL MERISTEM PROTEIN
1ut7_A1e-52715717167NO APICAL MERISTEM PROTEIN
1ut7_B1e-52715717167NO APICAL MERISTEM PROTEIN
4dul_A1e-52715717167NAC domain-containing protein 19
4dul_B1e-52715717167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629334.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9SV871e-123BRN2_ARATH; Protein BEARSKIN2
TrEMBLK4C7741e-156K4C774_SOLLC; Uncharacterized protein
STRINGSolyc06g063430.1.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-114NAC domain containing protein 70